PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009117976.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 321aa    MW: 35833.8 Da    PI: 5.8857
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009117976.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box36.21.2e-114793242
        zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                    + r+C+ +e+ ++ +fC+ +   lC  C  e+H+       H++vp+
  XP_009117976.1 47 RVRVCDSCESAPAAFFCKADAASLCTACDAEIHSAnplarrHQRVPI 93
                    5689*****************************66899999**9997 PP

2CCT65.81.2e-22252294143
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                     Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae RpR+KGrF+k+
  XP_009117976.1 252 REARVLRYREKKKRRKFEKTIRYASRKAYAEVRPRIKGRFAKR 294
                     9****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.51045IPR000315B-box-type zinc finger
CDDcd000210.001631349No hitNo description
SMARTSM003361.1E-174693IPR000315B-box-type zinc finger
PROSITE profilePS5011912.4294693IPR000315B-box-type zinc finger
PfamPF006432.9E-94893IPR000315B-box-type zinc finger
CDDcd000216.46E-114993No hitNo description
PROSITE profilePS5101716.42252294IPR010402CCT domain
PfamPF062032.5E-16252294IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MLKEESNESG GTRACDTCRS AACTIYREAD STYLCTTCDA RVHAAKRVRV CDSCESAPAA  60
FFCKADAASL CTACDAEIHS ANPLARRHQR VPITSNSCGS MATDGDNNVM MVSEEKEDAD  120
EVASWLMLNP GKNNQNNGFL FGVEYLDLVD YSSSIDNQFE DQYSKYHRSF GGGEDGVVPL  180
QLEESSTSHM QQSQHNFHLG VNYGYSTEPQ YSYVSVVPES SSDTTVQHAK ETIDQVCGPP  240
TQMVQQLTPA DREARVLRYR EKKKRRKFEK TIRYASRKAY AEVRPRIKGR FAKRIDMEAD  300
AEQLFSTSLM SNTSYGIVPS F
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1261265KKKRR
2261266KKKRRK
3262266KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3563700.0AY356370.1 Brassica rapa cultivar Samjin Col-2-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009117976.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-167COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLM4DY680.0M4DY68_BRARP; Uncharacterized protein
STRINGBra021464.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-138CONSTANS-like 2